SCOPe 2.08: Domain d1y6la1: 1y6l A:1-147

Lineage for d1y6la1 (1y6l A:1-147)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species)

7. Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry)
   Uniprot Q96LR5 54-201

8. Domain d1y6la1: 1y6l A:1-147 [116509]
   Other proteins in same PDB: d1y6la2, d1y6lb2, d1y6lc2

Details for d1y6la1

PDB Entry: 1y6l, 1.85 Å

PDB Description: Human ubiquitin conjugating enzyme E2E2

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2E2

SCOPe Domain Sequences for d1y6la1:

Sequence; same for both SEQRES and ATOM records:

>d1y6la1 d.20.1.1 (A:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]}
tsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspdy
pfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadplv
gsiatqymtnraehdrmarqwtkryat

Timeline for d1y6la1:

• d1y6la1 first appeared in SCOP 1.71, called d1y6la_
  
• d1y6la1 appears in SCOPe 2.07