![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
![]() | Superfamily d.20.1: UBC-like [54495] (5 families) ![]() |
![]() | Family d.20.1.1: UBC-related [54496] (7 proteins) |
![]() | Protein Ubiquitin conjugating enzyme, UBC [54497] (34 species) |
![]() | Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry) Uniprot Q96LR5 54-201 |
![]() | Domain d1y6lc1: 1y6l C:1-147 [116511] Other proteins in same PDB: d1y6la2, d1y6lb2, d1y6lc2 |
PDB Entry: 1y6l (more details), 1.85 Å
SCOPe Domain Sequences for d1y6lc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y6lc1 d.20.1.1 (C:1-147) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8 [TaxId: 9606]} tsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspdy pfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadplv gsiatqymtnraehdrmarqwtkryat
Timeline for d1y6lc1:
![]() Domains from other chains: (mouse over for more information) d1y6la1, d1y6la2, d1y6lb1, d1y6lb2 |