Lineage for d1y6la_ (1y6l A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 600733Fold d.20: UBC-like [54494] (1 superfamily)
    alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2
  4. 600734Superfamily d.20.1: UBC-like [54495] (3 families) (S)
  5. 600735Family d.20.1.1: Ubiquitin conjugating enzyme, UBC [54496] (1 protein)
  6. 600736Protein Ubiquitin conjugating enzyme, UBC [54497] (18 species)
  7. 600782Species Human (Homo sapiens), ubch8 [TaxId:9606] [117850] (1 PDB entry)
  8. 600783Domain d1y6la_: 1y6l A: [116509]

Details for d1y6la_

PDB Entry: 1y6l (more details), 1.85 Å

PDB Description: Human ubiquitin conjugating enzyme E2E2

SCOP Domain Sequences for d1y6la_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y6la_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch8}
stsakriqkelaeitldpppncsagpkgdniyewrstilgppgsvyeggvfflditfspd
ypfkppkvtfrtriyhcninsqgvicldilkdnwspaltiskvllsicslltdcnpadpl
vgsiatqymtnraehdrmarqwtkryat

SCOP Domain Coordinates for d1y6la_:

Click to download the PDB-style file with coordinates for d1y6la_.
(The format of our PDB-style files is described here.)

Timeline for d1y6la_: