SCOPe 2.08: Domain d1y1xa_: 1y1x A:

Lineage for d1y1xa_ (1y1x A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.8: Penta-EF-hand proteins [63550] (7 proteins)

6. Protein Programmed cell death 6 protein-like protein [116903] (1 species)

7. Species Leishmania major [TaxId:5664] [116904] (1 PDB entry)
   Uniprot Q4QG08 53-234

8. Domain d1y1xa_: 1y1x A: [116374]
   Structural genomics target
   complexed with ca, so4

Details for d1y1xa_

PDB Entry: 1y1x, 1.95 Å

PDB Description: Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin

PDB Compounds: (A:) Leishmania Major Homolog of Programmed Cell Death 6 Protein

SCOPe Domain Sequences for d1y1xa_:

Sequence; same for both SEQRES and ATOM records:

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]}
ptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekll
hmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseq
tfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvs
il

Timeline for d1y1xa_:

• d1y1xa_ first appeared in SCOP 1.71
  
• d1y1xa_ appears in SCOPe 2.07