Lineage for d1y1xa_ (1y1x A:)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 537532Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 537533Superfamily a.39.1: EF-hand [47473] (10 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 538080Family a.39.1.8: Penta-EF-hand proteins [63550] (6 proteins)
  6. 538127Protein Programmed cell death 6 protein-like protein [116903] (1 species)
  7. 538128Species Leishmania major [TaxId:5664] [116904] (1 PDB entry)
  8. 538129Domain d1y1xa_: 1y1x A: [116374]

Details for d1y1xa_

PDB Entry: 1y1x (more details), 1.95 Å

PDB Description: Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin

SCOP Domain Sequences for d1y1xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major}
ptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekll
hmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseq
tfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvs
il

SCOP Domain Coordinates for d1y1xa_:

Click to download the PDB-style file with coordinates for d1y1xa_.
(The format of our PDB-style files is described here.)

Timeline for d1y1xa_: