PDB entry 1y1x

View 1y1x on RCSB PDB site
Description: Structural analysis of a homolog of programmed cell death 6 protein from Leishmania major Friedlin
Class: structural genomics, unknown function
Keywords: SGPP, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, Structural Genomics of Pathogenic Protozoa Consortium, UNKNOWN FUNCTION
Deposited on 2004-11-19, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.19
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leishmania Major Homolog of Programmed Cell Death 6 Protein
    Species: Leishmania major [TaxId:347515]
    Gene: LmjF13.1460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1xa_
  • Chain 'B':
    Compound: Leishmania Major Homolog of Programmed Cell Death 6 Protein
    Species: Leishmania major [TaxId:347515]
    Gene: LmjF13.1460
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y1xb_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y1xA (A:)
    mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpf
    slattekllhmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraall
    ssgyqvseqtfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftf
    dtfiggsvsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1xA (A:)
    ptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpfslattekll
    hmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseq
    tfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvs
    il
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y1xB (B:)
    mahhhhhhmptstgvyapsarhmndnqelmewfravdtdgsgaisvpelnaalssagvpf
    slattekllhmydknhsgeitfdefkdlhhfilsmregfrkrdssgdgrldsnevraall
    ssgyqvseqtfqalmrkfdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftf
    dtfiggsvsil
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y1xB (B:)
    tstgvyapsqelmewfravdtdgsgaisvpelnaalssagvpfslattekllhmydknhs
    geitfdefkdlhhfilsmregfrkrdssgdgrldsnevraallssgyqvseqtfqalmrk
    fdrqrrgslgfddyvelsifvcrvrnvfafydrertgqvtftfdtfiggsvsil