SCOPe 2.07: Domain d1xx9c_: 1xx9 C:

Lineage for d1xx9c_ (1xx9 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology with the crossing loops

4. Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family)
   automatically mapped to Pfam PF03974

5. Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)

6. Protein Ecotin, trypsin inhibitor [49774] (1 species)

7. Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
   Uniprot P23827 23-162

8. Domain d1xx9c_: 1xx9 C: [116151]
   Other proteins in same PDB: d1xx9a_, d1xx9b_
   complexed with nag

Details for d1xx9c_

PDB Entry: 1xx9, 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r

PDB Compounds: (C:) ecotin

SCOPe Domain Sequences for d1xx9c_:

Sequence; same for both SEQRES and ATOM records:

>d1xx9c_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
tlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
vdvkyrvwkaeekidnavvr

Timeline for d1xx9c_:

• d1xx9c_ first appeared in SCOP 1.71
  
• d1xx9c_ appears in SCOPe 2.06
  
• d1xx9c_ appears in the current release, SCOPe 2.08