Lineage for d1xx9a_ (1xx9 A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404432Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2404847Protein Coagulation factor XI [117237] (1 species)
  7. 2404848Species Human (Homo sapiens) [TaxId:9606] [117238] (58 PDB entries)
    Uniprot P03951 388-624
  8. 2404883Domain d1xx9a_: 1xx9 A: [116149]
    Other proteins in same PDB: d1xx9c_, d1xx9d_
    complexed with nag

Details for d1xx9a_

PDB Entry: 1xx9 (more details), 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r
PDB Compounds: (A:) Coagulation factor XI

SCOPe Domain Sequences for d1xx9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx9a_ b.47.1.2 (A:) Coagulation factor XI {Human (Homo sapiens) [TaxId: 9606]}
ivggtasvrgewpwqvtlhttsptqrhlcggsiignqwiltaahcfygvespkilrvysg
ilnqseikedtsffgvqeiiihdqykmaesgydiallklettvnytdsqrpiclpskgdr
nviytdcwvtgwgyrklrdkiqntlqkakiplvtneecqkryrghkithkmicagyregg
kdackgdsggplsckhnevwhlvgitswgegcaqrerpgvytnvveyvdwilektqa

SCOPe Domain Coordinates for d1xx9a_:

Click to download the PDB-style file with coordinates for d1xx9a_.
(The format of our PDB-style files is described here.)

Timeline for d1xx9a_: