![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily) sandwich; 8 strands in 2 sheets; complex topology with the crossing loops |
![]() | Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) ![]() automatically mapped to Pfam PF03974 |
![]() | Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins) |
![]() | Protein Ecotin, trypsin inhibitor [49774] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [49775] (17 PDB entries) Uniprot P23827 23-162 |
![]() | Domain d1xx9c_: 1xx9 C: [116151] Other proteins in same PDB: d1xx9a_, d1xx9b_ complexed with nag |
PDB Entry: 1xx9 (more details), 2.2 Å
SCOPe Domain Sequences for d1xx9c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xx9c_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]} svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk tlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn vdvkyrvwkaeekidnavvr
Timeline for d1xx9c_: