Lineage for d1xx9c_ (1xx9 C:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2046179Fold b.16: Ecotin, trypsin inhibitor [49771] (1 superfamily)
    sandwich; 8 strands in 2 sheets; complex topology with the crossing loops
  4. 2046180Superfamily b.16.1: Ecotin, trypsin inhibitor [49772] (1 family) (S)
    automatically mapped to Pfam PF03974
  5. 2046181Family b.16.1.1: Ecotin, trypsin inhibitor [49773] (2 proteins)
  6. 2046182Protein Ecotin, trypsin inhibitor [49774] (1 species)
  7. 2046183Species Escherichia coli [TaxId:562] [49775] (17 PDB entries)
    Uniprot P23827 23-162
  8. 2046196Domain d1xx9c_: 1xx9 C: [116151]
    Other proteins in same PDB: d1xx9a_, d1xx9b_
    complexed with nag

Details for d1xx9c_

PDB Entry: 1xx9 (more details), 2.2 Å

PDB Description: crystal structure of the fxia catalytic domain in complex with ecotinm84r
PDB Compounds: (C:) ecotin

SCOPe Domain Sequences for d1xx9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xx9c_ b.16.1.1 (C:) Ecotin, trypsin inhibitor {Escherichia coli [TaxId: 562]}
svqplekiapypqaekgmkrqviqltpqedestlkvelligqtlevdcnlhrlggklenk
tlegwgydyyvfdkvsspvstrmacpdgkkekkfvtaylgdagmlrynsklpivvytpdn
vdvkyrvwkaeekidnavvr

SCOPe Domain Coordinates for d1xx9c_:

Click to download the PDB-style file with coordinates for d1xx9c_.
(The format of our PDB-style files is described here.)

Timeline for d1xx9c_: