SCOPe 2.08: Domain d1xqaa1: 1xqa A:1-112

Lineage for d1xqaa1 (1xqa A:1-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
   duplication: consists of two clear structural repeats each having this fold
   subunit fold and dimeric assembly are similar to those of glyoxalase

6. Protein Hypothetical protein BC3580 [117870] (1 species)

7. Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry)
   Uniprot Q81AI8

8. Domain d1xqaa1: 1xqa A:1-112 [115837]
   Other proteins in same PDB: d1xqaa2
   Structural genomics target
   complexed with mg, p6g

Details for d1xqaa1

PDB Entry: 1xqa, 1.8 Å

PDB Description: Structure of a possible Glyoxalase from Bacillus cereus

PDB Compounds: (A:) Glyoxalase/Bleomycin resistance protein

SCOPe Domain Sequences for d1xqaa1:

Sequence, based on SEQRES records:

>d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt
fhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

Sequence, based on observed residues (ATOM records):

>d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt
fhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc

Timeline for d1xqaa1:

• d1xqaa1 first appeared in SCOP 1.71, called d1xqaa_
  
• d1xqaa1 appears in SCOPe 2.07