![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Hypothetical protein BC3580 [117870] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry) Uniprot Q81AI8 |
![]() | Domain d1xqaa1: 1xqa A:1-112 [115837] Other proteins in same PDB: d1xqaa2 Structural genomics target complexed with mg, p6g |
PDB Entry: 1xqa (more details), 1.8 Å
SCOPe Domain Sequences for d1xqaa1:
Sequence, based on SEQRES records: (download)
>d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt fhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc
>d1xqaa1 d.32.1.2 (A:1-112) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]} mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt fhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc
Timeline for d1xqaa1: