Lineage for d1xqab_ (1xqa B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2942376Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2942377Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2942433Family d.32.1.2: Antibiotic resistance proteins [54598] (8 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 2942486Protein Hypothetical protein BC3580 [117870] (1 species)
  7. 2942487Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry)
    Uniprot Q81AI8
  8. 2942489Domain d1xqab_: 1xqa B: [115838]
    Other proteins in same PDB: d1xqaa2
    Structural genomics target
    complexed with mg, p6g

Details for d1xqab_

PDB Entry: 1xqa (more details), 1.8 Å

PDB Description: Structure of a possible Glyoxalase from Bacillus cereus
PDB Compounds: (B:) Glyoxalase/Bleomycin resistance protein

SCOPe Domain Sequences for d1xqab_:

Sequence, based on SEQRES records: (download)

>d1xqab_ d.32.1.2 (B:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt
fhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

Sequence, based on observed residues (ATOM records): (download)

>d1xqab_ d.32.1.2 (B:) Hypothetical protein BC3580 {Bacillus cereus [TaxId: 1396]}
mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt
fhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc

SCOPe Domain Coordinates for d1xqab_:

Click to download the PDB-style file with coordinates for d1xqab_.
(The format of our PDB-style files is described here.)

Timeline for d1xqab_: