![]() | Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) ![]() |
![]() | Family d.32.1.2: Antibiotic resistance proteins [54598] (5 proteins) duplication: consists of two clear structural repeats each having this fold subunit fold and dimeric assembly are similar to those of glyoxalase |
![]() | Protein Hypothetical protein BC3580 [117870] (1 species) |
![]() | Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry) |
![]() | Domain d1xqaa_: 1xqa A: [115837] |
PDB Entry: 1xqa (more details), 1.8 Å
SCOP Domain Sequences for d1xqaa_:
Sequence, based on SEQRES records: (download)
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus} amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk tfhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc
>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus} amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk tfhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc
Timeline for d1xqaa_: