Lineage for d1xqaa_ (1xqa A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 601425Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 601426Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (9 families) (S)
  5. 601455Family d.32.1.2: Antibiotic resistance proteins [54598] (5 proteins)
    duplication: consists of two clear structural repeats each having this fold
    subunit fold and dimeric assembly are similar to those of glyoxalase
  6. 601505Protein Hypothetical protein BC3580 [117870] (1 species)
  7. 601506Species Bacillus cereus [TaxId:1396] [117871] (1 PDB entry)
  8. 601507Domain d1xqaa_: 1xqa A: [115837]

Details for d1xqaa_

PDB Entry: 1xqa (more details), 1.8 Å

PDB Description: Structure of a possible Glyoxalase from Bacillus cereus

SCOP Domain Sequences for d1xqaa_:

Sequence, based on SEQRES records: (download)

>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus}
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

Sequence, based on observed residues (ATOM records): (download)

>d1xqaa_ d.32.1.2 (A:) Hypothetical protein BC3580 {Bacillus cereus}
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc

SCOP Domain Coordinates for d1xqaa_:

Click to download the PDB-style file with coordinates for d1xqaa_.
(The format of our PDB-style files is described here.)

Timeline for d1xqaa_: