PDB entry 1xqa

View 1xqa on RCSB PDB site
Description: Structure of a possible Glyoxalase from Bacillus cereus
Class: structural genomics, unknown function
Keywords: Dioxygenase, Glyoxalase/Bleomycin resistance, structural genomics, Midwest Center for Structural Genomics, MCSG, Protein Structure Initiative, PSI, UNKNOWN FUNCTION
Deposited on 2004-10-11, released 2004-11-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.192
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glyoxalase/Bleomycin resistance protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP10513
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81AI8 (1-112)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (39)
      • modified residue (50)
      • modified residue (111)
    Domains in SCOPe 2.08: d1xqaa1, d1xqaa2
  • Chain 'B':
    Compound: Glyoxalase/Bleomycin resistance protein
    Species: Bacillus cereus [TaxId:226900]
    Gene: AAP10513
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81AI8 (1-112)
      • modified residue (1)
      • modified residue (39)
      • modified residue (50)
      • modified residue (111)
    Domains in SCOPe 2.08: d1xqab_
  • Heterogens: MG, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1xqaA (A:)
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

    Sequence, based on observed residues (ATOM records): (download) 
    >1xqaA (A:)
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >1xqaB (B:)
amgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypk
tfhvgfpqeseeqvdkinqrlkedgflveppkhahaytfyveapggftievmc

    Sequence, based on observed residues (ATOM records): (download) 
    >1xqaB (B:)
mgikhlnltvadvvaareflekyfgltcsgtrgnafavmrdndgfiltlmkgkevqypkt
fhvgfpqeseeqvdkinqrlkedgflveppkhaaytfyveapggftievmc