| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
| Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
| Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain [419029] (2 species) most similar to FabH |
| Domain d1xpmb2: 1xpm B:168-388 [115762] Other proteins in same PDB: d1xpma1, d1xpma3, d1xpma4, d1xpmb1, d1xpmb3, d1xpmb4, d1xpmc1, d1xpmc3, d1xpmc4, d1xpmd1, d1xpmd3, d1xpmd4 complexed with caa, hmg, so4 has additional subdomain(s) that are not in the common domain |
PDB Entry: 1xpm (more details), 1.6 Å
SCOPe Domain Sequences for d1xpmb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpmb2 c.95.1.2 (B:168-388) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, C-terminal domain {Staphylococcus aureus [TaxId: 1280]}
ilalnedavaytedvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladf
aslcfhvpftkmgkkalesiidnadettqerlrsgyedavdynryvgniytgslylslis
llenrdlqagetiglfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdaye
tffkrfddvefdeeqdavhedrhifylsniennvreyhrpe
Timeline for d1xpmb2: