Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins) |
Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species) most similar to FabH |
Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries) Uniprot Q7A3F6 |
Domain d1xpmb1: 1xpm B:3-167 [115761] Other proteins in same PDB: d1xpma2, d1xpma3, d1xpma4, d1xpmb2, d1xpmb3, d1xpmb4, d1xpmc2, d1xpmc3, d1xpmc4, d1xpmd2, d1xpmd3, d1xpmd4 complexed with caa, hmg, so4 |
PDB Entry: 1xpm (more details), 1.6 Å
SCOPe Domain Sequences for d1xpmb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xpmb1 c.95.1.2 (B:3-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]} igidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakdi itdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqlak dylatrpnekvlviatdtaryglnsggeptqgagavamviahnps
Timeline for d1xpmb1: