PDB entry 1xpm

View 1xpm on RCSB PDB site
Description: Crystal Structure of Staphylococcus aureus HMG-COA Synthase with HMG-CoA and Acetoacetyl-COA and Acetylated Cysteine
Class: transferase
Keywords: HMG-COA Synthase, HMGS, Coenzyme A, Thiolase Fold, Condensing Enzyme, Cholesterol Biosynthesis, TRANSFERASE
Deposited on 2004-10-08, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.07: d1xpma1, d1xpma2, d1xpma3, d1xpma4
  • Chain 'B':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.07: d1xpmb1, d1xpmb2, d1xpmb3, d1xpmb4
  • Chain 'C':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.07: d1xpmc1, d1xpmc2, d1xpmc3, d1xpmc4
  • Chain 'D':
    Compound: 3-hydroxy-3-methylglutaryl CoA synthase
    Species: Staphylococcus aureus [TaxId:46170]
    Gene: mvaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q79ZY6 (Start-387)
      • cloning artifact (1)
      • microheterogeneity (110)
      • cloning artifact (388-389)
    Domains in SCOPe 2.07: d1xpmd1, d1xpmd2, d1xpmd3, d1xpmd4
  • Heterogens: SO4, HMG, CAA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xpmA (A:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpmA (A:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xpmB (B:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpmB (B:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xpmC (C:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpmC (C:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xpmD (D:)
    maigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaak
    diitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiql
    akdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayte
    dvydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmg
    kkalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqageti
    glfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefde
    eqdavhedrhifylsniennvreyhrpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xpmD (D:)
    aigidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakd
    iitdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqla
    kdylatrpnekvlviatdtaryglnsggeptqgagavamviahnpsilalnedavayted
    vydfwrptghkyplvdgalskdayirsfqqswneyakrqgksladfaslcfhvpftkmgk
    kalesiidnadettqerlrsgyedavdynryvgniytgslylslisllenrdlqagetig
    lfsygsgsvgefysatlvegykdhldqaahkallnnrtevsvdayetffkrfddvefdee
    qdavhedrhifylsniennvreyhrpele