Lineage for d1xpmd1 (1xpm D:3-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916987Family c.95.1.2: Chalcone synthase-like [53914] (15 proteins)
  6. 2917020Protein 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain [419028] (2 species)
    most similar to FabH
  7. 2917034Species Staphylococcus aureus [TaxId:1280] [419512] (5 PDB entries)
    Uniprot Q7A3F6
  8. 2917039Domain d1xpmd1: 1xpm D:3-167 [115765]
    Other proteins in same PDB: d1xpma2, d1xpma3, d1xpma4, d1xpmb2, d1xpmb3, d1xpmb4, d1xpmc2, d1xpmc3, d1xpmc4, d1xpmd2, d1xpmd3, d1xpmd4
    complexed with caa, hmg, so4

Details for d1xpmd1

PDB Entry: 1xpm (more details), 1.6 Å

PDB Description: crystal structure of staphylococcus aureus hmg-coa synthase with hmg- coa and acetoacetyl-coa and acetylated cysteine
PDB Compounds: (D:) 3-hydroxy-3-methylglutaryl CoA synthase

SCOPe Domain Sequences for d1xpmd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xpmd1 c.95.1.2 (D:3-167) 3-hydroxy-3-methylglutaryl CoA synthase MvaS, N-terminal domain {Staphylococcus aureus [TaxId: 1280]}
igidkinfyvpkyyvdmaklaearqvdpnkfligigqtemavspvnqdivsmganaakdi
itdedkkkigmvivatesavdaakaaavqihnllgiqpfarcfemkeacyaatpaiqlak
dylatrpnekvlviatdtaryglnsggeptqgagavamviahnps

SCOPe Domain Coordinates for d1xpmd1:

Click to download the PDB-style file with coordinates for d1xpmd1.
(The format of our PDB-style files is described here.)

Timeline for d1xpmd1: