Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 has additional subdomain(s) that are not in the common domain |
Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry) Uniprot Q6UWP2 |
Domain d1xg5c1: 1xg5 C:2-256 [115279] Other proteins in same PDB: d1xg5a2, d1xg5b2, d1xg5c2, d1xg5d2 complexed with acy, nap |
PDB Entry: 1xg5 (more details), 1.53 Å
SCOPe Domain Sequences for d1xg5c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xg5c1 c.2.1.2 (C:2-256) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls tpahiqigdiqmrpt
Timeline for d1xg5c1: