SCOPe 2.08: Domain d1xg5c1: 1xg5 C:2-256

Lineage for d1xg5c1 (1xg5 C:2-256)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry)
   Uniprot Q6UWP2

8. Domain d1xg5c1: 1xg5 C:2-256 [115279]
   Other proteins in same PDB: d1xg5a2, d1xg5b2, d1xg5c2, d1xg5d2
   complexed with acy, nap

Details for d1xg5c1

PDB Entry: 1xg5, 1.53 Å

PDB Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP

PDB Compounds: (C:) arpg836

SCOPe Domain Sequences for d1xg5c1:

Sequence; same for both SEQRES and ATOM records:

>d1xg5c1 c.2.1.2 (C:2-256) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
tpahiqigdiqmrpt

Timeline for d1xg5c1:

• d1xg5c1 first appeared in SCOP 1.71, called d1xg5c_
  
• d1xg5c1 appears in SCOPe 2.07