Lineage for d1xg5a1 (1xg5 A:2-256)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842703Protein Putative dehydrogenase ARPG836 (MGC4172) [117411] (1 species)
  7. 2842704Species Human (Homo sapiens) [TaxId:9606] [117412] (1 PDB entry)
    Uniprot Q6UWP2
  8. 2842705Domain d1xg5a1: 1xg5 A:2-256 [115277]
    Other proteins in same PDB: d1xg5a2, d1xg5b2, d1xg5c2, d1xg5d2
    complexed with acy, nap

Details for d1xg5a1

PDB Entry: 1xg5 (more details), 1.53 Å

PDB Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP
PDB Compounds: (A:) arpg836

SCOPe Domain Sequences for d1xg5a1:

Sequence, based on SEQRES records: (download)

>d1xg5a1 c.2.1.2 (A:2-256) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
tpahiqigdiqmrpt

Sequence, based on observed residues (ATOM records): (download)

>d1xg5a1 c.2.1.2 (A:2-256) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]}
arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
qelreaqthiratcispgvvetqfafklhdkdpekaaatyeclkpedvaeaviyvlstpa
hiqigdiqmrpt

SCOPe Domain Coordinates for d1xg5a1:

Click to download the PDB-style file with coordinates for d1xg5a1.
(The format of our PDB-style files is described here.)

Timeline for d1xg5a1: