PDB entry 1xg5

View 1xg5 on RCSB PDB site
Description: Structure of human putative dehydrogenase MGC4172 in complex with NADP
Class: oxidoreductase
Keywords: Short Chain Dehydrogenase, Human, SGC, structural genomics, Structural Genomics Consortium, OXIDOREDUCTASE
Deposited on 2004-09-16, released 2004-10-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.162
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arpg836
    Species: Homo sapiens [TaxId:9606]
    Gene: MGC4172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UWP2 (Start-276)
      • cloning artifact (277-278)
    Domains in SCOPe 2.07: d1xg5a1, d1xg5a2
  • Chain 'B':
    Compound: arpg836
    Species: Homo sapiens [TaxId:9606]
    Gene: MGC4172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UWP2 (Start-276)
      • cloning artifact (277-278)
    Domains in SCOPe 2.07: d1xg5b1, d1xg5b2
  • Chain 'C':
    Compound: arpg836
    Species: Homo sapiens [TaxId:9606]
    Gene: MGC4172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UWP2 (Start-276)
      • cloning artifact (277-278)
    Domains in SCOPe 2.07: d1xg5c1, d1xg5c2
  • Chain 'D':
    Compound: arpg836
    Species: Homo sapiens [TaxId:9606]
    Gene: MGC4172
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6UWP2 (Start-276)
      • cloning artifact (277-278)
    Domains in SCOPe 2.07: d1xg5d1, d1xg5d2
  • Heterogens: NAP, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xg5A (A:)
    gsshhhhhhssgrenlyfqghmarpgmerwrdrlalvtgasggigaavaralvqqglkvv
    gcartvgnieelaaecksagypgtlipyrcdlsneedilsmfsairsqhsgvdicinnag
    larpdtllsgstsgwkdmfnvnvlalsictreayqsmkernvddghiininsmsghrvlp
    lsvthfysatkyavtalteglrqelreaqthiratcispgvvetqfafklhdkdpekaaa
    tyeqmkclkpedvaeaviyvlstpahiqigdiqmrptgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg5A (A:)
    arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
    gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
    vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
    qelreaqthiratcispgvvetqfafklhdkdpekaaatyeclkpedvaeaviyvlstpa
    hiqigdiqmrptgs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xg5B (B:)
    gsshhhhhhssgrenlyfqghmarpgmerwrdrlalvtgasggigaavaralvqqglkvv
    gcartvgnieelaaecksagypgtlipyrcdlsneedilsmfsairsqhsgvdicinnag
    larpdtllsgstsgwkdmfnvnvlalsictreayqsmkernvddghiininsmsghrvlp
    lsvthfysatkyavtalteglrqelreaqthiratcispgvvetqfafklhdkdpekaaa
    tyeqmkclkpedvaeaviyvlstpahiqigdiqmrptgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg5B (B:)
    arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
    gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
    vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
    qelreaqthiratcispgvvetqfafklhmkclkpedvaeaviyvlstpahiqigdiqmr
    ptgs
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xg5C (C:)
    gsshhhhhhssgrenlyfqghmarpgmerwrdrlalvtgasggigaavaralvqqglkvv
    gcartvgnieelaaecksagypgtlipyrcdlsneedilsmfsairsqhsgvdicinnag
    larpdtllsgstsgwkdmfnvnvlalsictreayqsmkernvddghiininsmsghrvlp
    lsvthfysatkyavtalteglrqelreaqthiratcispgvvetqfafklhdkdpekaaa
    tyeqmkclkpedvaeaviyvlstpahiqigdiqmrptgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg5C (C:)
    arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
    gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
    vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
    qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
    tpahiqigdiqmrptgs
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xg5D (D:)
    gsshhhhhhssgrenlyfqghmarpgmerwrdrlalvtgasggigaavaralvqqglkvv
    gcartvgnieelaaecksagypgtlipyrcdlsneedilsmfsairsqhsgvdicinnag
    larpdtllsgstsgwkdmfnvnvlalsictreayqsmkernvddghiininsmsghrvlp
    lsvthfysatkyavtalteglrqelreaqthiratcispgvvetqfafklhdkdpekaaa
    tyeqmkclkpedvaeaviyvlstpahiqigdiqmrptgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xg5D (D:)
    arpgmerwrdrlalvtgasggigaavaralvqqglkvvgcartvgnieelaaecksagyp
    gtlipyrcdlsneedilsmfsairsqhsgvdicinnaglarpdtllsgstsgwkdmfnvn
    vlalsictreayqsmkernvddghiininsmsghrvlplsvthfysatkyavtalteglr
    qelreaqthiratcispgvvetqfafklhdkdpekaaatyeqmkclkpedvaeaviyvls
    tpahiqigdiqmrptgs