Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
Protein Hypothetical protein PA0115 [118066] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry) Uniprot Q9I717 |
Domain d1xebg_: 1xeb G: [115225] Structural genomics target |
PDB Entry: 1xeb (more details), 2.35 Å
SCOPe Domain Sequences for d1xebg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xebg_ d.108.1.1 (G:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]} ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq ayygrygfvavtevyleddiphigmrr
Timeline for d1xebg_: