PDB entry 1xeb

View 1xeb on RCSB PDB site
Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa
Class: transferase
Keywords: Midwest Center for Structural Genomics, MCSG, Structural Genomics, Protein Structure Initiative, PSI, APC22065, TRANSFERASE
Deposited on 2004-09-09, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.35 Å
R-factor: 0.232
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xeba_
  • Chain 'B':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebb_
  • Chain 'C':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebc_
  • Chain 'D':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebd_
  • Chain 'E':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebe_
  • Chain 'F':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebf_
  • Chain 'G':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebg_
  • Chain 'H':
    Compound: hypothetical protein PA0115
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: PA01
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I717 (Start-149)
      • modified residue (52)
      • modified residue (96)
      • modified residue (146)
    Domains in SCOPe 2.07: d1xebh_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xebA (A:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebA (A:)
    sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
    aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
    qayygrygfvavtevyleddiphigmrra
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xebB (B:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebB (B:)
    sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
    aylrlldpvrhegqvvigrvvsssaarqglghqlmeralqaaerlwldtpvylsaqahlq
    ayygrygfvavtevyleddiphigmrra
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xebC (C:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebC (C:)
    sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
    aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
    qayygrygfvavtevyleddiphigmrra
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xebD (D:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebD (D:)
    ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
    ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq
    ayygrygfvavtevyleddiphigmrra
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xebE (E:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebE (E:)
    sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
    aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
    qayygrygfvavtevylephigmrra
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xebF (F:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebF (F:)
    ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
    ylrlldpvrhegqvvigrvvsssaarlghqlmeralqaaerlwldtpvylsaqahlqayy
    grygfvavtevyleddiphigmrra
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xebG (G:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebG (G:)
    ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
    ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq
    ayygrygfvavtevyleddiphigmrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xebH (H:)
    msldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgql
    laylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqah
    lqayygrygfvavtevyleddiphigmrra
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xebH (H:)
    ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
    ylrlldpvrhegqvvigrvvsssaarglghqlmeralqaaerlwldtpvylsaqahlqay
    ygrygfvavtevyleddiphigmrra