Lineage for d1xebe_ (1xeb E:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968516Protein Hypothetical protein PA0115 [118066] (1 species)
  7. 2968517Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry)
    Uniprot Q9I717
  8. 2968522Domain d1xebe_: 1xeb E: [115223]
    Structural genomics target

Details for d1xebe_

PDB Entry: 1xeb (more details), 2.35 Å

PDB Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa
PDB Compounds: (E:) hypothetical protein PA0115

SCOPe Domain Sequences for d1xebe_:

Sequence, based on SEQRES records: (download)

>d1xebe_ d.108.1.1 (E:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
qayygrygfvavtevyleddiphigmrra

Sequence, based on observed residues (ATOM records): (download)

>d1xebe_ d.108.1.1 (E:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
sldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqll
aylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahl
qayygrygfvavtevylephigmrra

SCOPe Domain Coordinates for d1xebe_:

Click to download the PDB-style file with coordinates for d1xebe_.
(The format of our PDB-style files is described here.)

Timeline for d1xebe_: