SCOPe 2.08: Domain d1xebh_: 1xeb H:

Lineage for d1xebh_ (1xeb H:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein Hypothetical protein PA0115 [118066] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [118067] (1 PDB entry)
   Uniprot Q9I717

8. Domain d1xebh_: 1xeb H: [115226]
   Structural genomics target

Details for d1xebh_

PDB Entry: 1xeb, 2.35 Å

PDB Description: Crystal Structure of an Acyl-CoA N-acyltransferase from Pseudomonas aeruginosa

PDB Compounds: (H:) hypothetical protein PA0115

SCOPe Domain Sequences for d1xebh_:

Sequence, based on SEQRES records:

>d1xebh_ d.108.1.1 (H:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
ylrlldpvrhegqvvigrvvsssaargqglghqlmeralqaaerlwldtpvylsaqahlq
ayygrygfvavtevyleddiphigmrra

Sequence, based on observed residues (ATOM records):

>d1xebh_ d.108.1.1 (H:) Hypothetical protein PA0115 {Pseudomonas aeruginosa [TaxId: 287]}
ldwtckhhadltlkelyallqlrtevfvveqkcpyqevdgldlvgdthhlmawrdgqlla
ylrlldpvrhegqvvigrvvsssaarglghqlmeralqaaerlwldtpvylsaqahlqay
ygrygfvavtevyleddiphigmrra

Timeline for d1xebh_:

• d1xebh_ first appeared in SCOP 1.71
  
• d1xebh_ appears in SCOPe 2.07