SCOPe 2.08: Domain d1xdua1: 1xdu A:10-101

Lineage for d1xdua1 (1xdu A:10-101)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
   unknown function

6. Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species)
   evolved a different function; binds SAM and SAH

7. Species Streptomyces purpurascens [TaxId:1924] [101036] (4 PDB entries)
   Uniprot Q54527

8. Domain d1xdua1: 1xdu A:10-101 [115178]
   Other proteins in same PDB: d1xdua2
   complexed with act, sfg

Details for d1xdua1

PDB Entry: 1xdu, 2.7 Å

PDB Description: Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with Sinefungin (SFG)

PDB Compounds: (A:) Protein RdmB

SCOPe Domain Sequences for d1xdua1:

Sequence, based on SEQRES records:

>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekqgrplrptrlgmlladg

Sequence, based on observed residues (ATOM records):

>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekgrplrptrlgmlladg

Timeline for d1xdua1:

• d1xdua1 first appeared in SCOP 1.71
  
• d1xdua1 appears in SCOPe 2.07