Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins) unknown function |
Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species) evolved a different function; binds SAM and SAH |
Species Streptomyces purpurascens [TaxId:1924] [101036] (4 PDB entries) Uniprot Q54527 |
Domain d1xdua1: 1xdu A:10-101 [115178] Other proteins in same PDB: d1xdua2 complexed with act, sfg |
PDB Entry: 1xdu (more details), 2.7 Å
SCOPe Domain Sequences for d1xdua1:
Sequence, based on SEQRES records: (download)
>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl vrhltvvgvleggekqgrplrptrlgmlladg
>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl vrhltvvgvleggekgrplrptrlgmlladg
Timeline for d1xdua1: