PDB entry 1xdu

View 1xdu on RCSB PDB site
Description: Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with Sinefungin (SFG)
Class: transferase
Keywords: Anthracycline; hydroxylase; S-adenosyl-L-methionine analogue; sinefungin; streptomyces; polyketide antibiotics; divergent evolution, transferase
Deposited on 2004-09-08, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.231
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein RdmB
    Species: Streptomyces purpurascens [TaxId:1924]
    Gene: rdmb
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q54527
      • modified residue (30)
      • modified residue (95)
      • modified residue (162)
      • modified residue (195)
      • modified residue (307)
      • modified residue (311)
    Domains in SCOPe 2.07: d1xdua1, d1xdua2
  • Heterogens: ACT, SFG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xduA (A:)
    msssspgepleptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtd
    thpqalsrlvrhltvvgvleggekqgrplrptrlgmlladghpaqqrawldlngavshad
    laftglldvvrtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydw
    savrhvldvgggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegd
    ffkplpvtadvvllsfvllnwsdedaltilrgcvralepggrllvldradvegdgadrff
    stlldlrmltfmggrvrtrdevvdlagsaglalasertsgsttlpfdfsileftavseea
    apaaqasealpaqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xduA (A:)
    leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
    vrhltvvgvleggekgrplrptrlgmlladghpaqqrawldlngavshadlaftglldvv
    rtgrpayagrygrpfwedlsadvaladsfdalmscdedlayeapadaydwsavrhvldvg
    ggnggmlaaialraphlrgtlvelagpaerarrrfadagladrvtvaegdffkplpvtad
    vvllsfvllnwsdedaltilrgcvralepggrllvldradrffstlldlrmltfmggrvr
    trdevvdlagsaglalasertsgsttlpfdfsileftavs