Lineage for d1xdua1 (1xdu A:10-101)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 532780Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 533238Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (61 families) (S)
    contains a small beta-sheet (wing)
  5. 533690Family a.4.5.29: Plant O-methyltransferase, N-terminal domain [63475] (5 proteins)
    unknown function
  6. 533691Protein Aclacinomycin-10-hydroxylase RdmB [101035] (1 species)
    evolved a different function; binds SAM and SAH
  7. 533692Species Streptomyces purpurascens [TaxId:1924] [101036] (4 PDB entries)
  8. 533697Domain d1xdua1: 1xdu A:10-101 [115178]
    Other proteins in same PDB: d1xdua2
    complexed with act, sfg

Details for d1xdua1

PDB Entry: 1xdu (more details), 2.7 Å

PDB Description: Crystal structure of Aclacinomycin-10-hydroxylase (RdmB) in complex with Sinefungin (SFG)

SCOP Domain Sequences for d1xdua1:

Sequence, based on SEQRES records: (download)

>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekqgrplrptrlgmlladg

Sequence, based on observed residues (ATOM records): (download)

>d1xdua1 a.4.5.29 (A:10-101) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens}
leptdqdldvllknlgnlvtpmalrvaatlrlvdhllagadtlagladrtdthpqalsrl
vrhltvvgvleggekgrplrptrlgmlladg

SCOP Domain Coordinates for d1xdua1:

Click to download the PDB-style file with coordinates for d1xdua1.
(The format of our PDB-style files is described here.)

Timeline for d1xdua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xdua2