Lineage for d1xd4a1 (1xd4 A:200-404)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002135Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2002136Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2002137Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 protein domains)
    Pfam PF00621
  6. 2002187Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 2002188Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
    Uniprot Q07889 189-1046
  8. 2002192Domain d1xd4a1: 1xd4 A:200-404 [115149]
    Other proteins in same PDB: d1xd4a2, d1xd4a3, d1xd4b2, d1xd4b3

Details for d1xd4a1

PDB Entry: 1xd4 (more details), 3.64 Å

PDB Description: Crystal structure of the DH-PH-cat module of Son of Sevenless (SOS)
PDB Compounds: (A:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd4a1 a.87.1.1 (A:200-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
llnvqsgmekicskslakrrlsesa

SCOPe Domain Coordinates for d1xd4a1:

Click to download the PDB-style file with coordinates for d1xd4a1.
(The format of our PDB-style files is described here.)

Timeline for d1xd4a1: