Lineage for d1xd4b2 (1xd4 B:568-1044)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.117: Ras GEF [48365] (1 superfamily)
    multihelical
  4. Superfamily a.117.1: Ras GEF [48366] (1 family) (S)
  5. Family a.117.1.1: Ras GEF [48367] (2 proteins)
  6. Protein Son of sevenless protein homolog 1 (sos-1) [48368] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [48369] (60 PDB entries)
    Uniprot Q07889 189-1046
  8. Domain d1xd4b2: 1xd4 B:568-1044 [115153]
    Other proteins in same PDB: d1xd4a1, d1xd4a3, d1xd4b1, d1xd4b3

Details for d1xd4b2

PDB Entry: 1xd4 (more details), 3.64 Å

PDB Description: crystal structure of the dh-ph-cat module of son of sevenless (sos)
PDB Compounds: (B:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd4b2:

Sequence, based on SEQRES records: (download)

>d1xd4b2 a.117.1.1 (B:568-1044) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
rlpsadvyrfaepdseeniifeenmqpkagipiikagtviklierltyhmyadpnfvrtf
lttyrsfckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvql
rvlnvcrhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiardng
pghnitfqsspptvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgs
vwtkedkeinspnllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnn
fngvlevvsamnsspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcv
pffgiyltnilkteegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdi
krffenlnpmgnsmekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsn

Sequence, based on observed residues (ATOM records): (download)

>d1xd4b2 a.117.1.1 (B:568-1044) Son of sevenless protein homolog 1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
rlpsadvyrfaepdseeniifeegipiikagtviklierltyhmyadpnfvrtflttyrs
fckpqellsliierfeipepepteadriaiengdqplsaelkrfrkeyiqpvqlrvlnvc
rhwvehhfydferdayllqrmeefigtvrgkamkkwvesitkiiqrkkiahnitfqsspp
tvewhisrpghietfdlltlhpieiarqltllesdlyravqpselvgsvwtkedkeinsp
nllkmirhttnltlwfekcivetenleervavvsriieilqvfqelnnfngvlevvsamn
sspvyrldhtfeqipsrqkkileeahelsedhykkylaklrsinppcvpffgiyltnilk
teegnpevlkrhgkelinfskrrkvaeitgeiqqyqnqpyclrvesdikrffenlnpmgn
smekeftdylfnksleieprnpkplprfpkkysyplkspgvrpsn

SCOPe Domain Coordinates for d1xd4b2 are not available.

Timeline for d1xd4b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1xd4b1, d1xd4b3
View in 3D
Domains from other chains:
(mouse over for more information)
d1xd4a1, d1xd4a2, d1xd4a3