SCOPe 2.08: Domain d1xd4a3: 1xd4 A:419-549

Lineage for d1xd4a3 (1xd4 A:419-549)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (14 families)

5. Family b.55.1.1: Pleckstrin-homology domain (PH domain) [50730] (48 proteins)
   Pfam PF00169

6. Protein Son of sevenless-1 (sos-1) [50742] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50744] (4 PDB entries)
   Uniprot Q07889 189-1046

8. Domain d1xd4a3: 1xd4 A:419-549 [115151]
   Other proteins in same PDB: d1xd4a1, d1xd4a2, d1xd4b1, d1xd4b2

Details for d1xd4a3

PDB Entry: 1xd4, 3.64 Å

PDB Description: crystal structure of the dh-ph-cat module of son of sevenless (sos)

PDB Compounds: (A:) Son of sevenless protein homolog 1

SCOPe Domain Sequences for d1xd4a3:

Sequence; same for both SEQRES and ATOM records:

>d1xd4a3 b.55.1.1 (A:419-549) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]}
ikkmneiqknidgwegkdigqccnefimegtltrvgakherhiflfdglmiccksnhgqp
rlpgasnaeyrlkekffmrkvqindkddtneykhafeiilkdensvifsaksaeeknnwm
aalislqyrst

Timeline for d1xd4a3:

• d1xd4a3 first appeared in SCOP 1.71
  
• d1xd4a3 appears in SCOPe 2.07