Lineage for d1xd4a1 (1xd4 A:200-404)

  1. Root: SCOP 1.71
  2. 530466Class a: All alpha proteins [46456] (226 folds)
  3. 540906Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 540907Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (1 family) (S)
  5. 540908Family a.87.1.1: DBL homology domain (DH-domain) [48066] (9 proteins)
    Pfam 00621
  6. 540950Protein Son of sevenless-1 (sos-1) [48067] (1 species)
  7. 540951Species Human (Homo sapiens) [TaxId:9606] [48068] (3 PDB entries)
  8. 540955Domain d1xd4a1: 1xd4 A:200-404 [115149]
    Other proteins in same PDB: d1xd4a2, d1xd4a3, d1xd4b2, d1xd4b3

Details for d1xd4a1

PDB Entry: 1xd4 (more details), 3.64 Å

PDB Description: crystal structure of the dh-ph-cat module of son of sevenless (sos)

SCOP Domain Sequences for d1xd4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xd4a1 a.87.1.1 (A:200-404) Son of sevenless-1 (sos-1) {Human (Homo sapiens)}
tyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsvkl
lghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlskpg
aalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqaita
llnvqsgmekicskslakrrlsesa

SCOP Domain Coordinates for d1xd4a1:

Click to download the PDB-style file with coordinates for d1xd4a1.
(The format of our PDB-style files is described here.)

Timeline for d1xd4a1: