SCOPe 2.06: Domain d1xb1f_: 1xb1 F:

Lineage for d1xb1f_ (1xb1 F:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein BIR-containing protein 8 [118349] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)
   Uniprot Q96P09 1-84

8. Domain d1xb1f_: 1xb1 F: [115053]
   first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L
   complexed with zn

Details for d1xb1f_

PDB Entry: 1xb1, 2.7 Å

PDB Description: The Structure of the BIR domain of IAP-like protein 2

PDB Compounds: (F:) Baculoviral IAP repeat-containing protein 8

SCOPe Domain Sequences for d1xb1f_:

Sequence; same for both SEQRES and ATOM records:

>d1xb1f_ g.52.1.1 (F:) BIR-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]}
nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
dpweqhakwypgckylleekgheyinnih

Timeline for d1xb1f_:

• d1xb1f_ first appeared in SCOP 1.71
  
• d1xb1f_ appears in SCOPe 2.05
  
• d1xb1f_ appears in SCOPe 2.07
  
• d1xb1f_ appears in the current release, SCOPe 2.08