Lineage for d1xb1f_ (1xb1 F:)

  1. Root: SCOP 1.71
  2. 621190Class g: Small proteins [56992] (79 folds)
  3. 625326Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 625327Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (1 family) (S)
  5. 625328Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (6 proteins)
  6. 625388Protein BIR-containing protein 8 [118349] (1 species)
  7. 625389Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)
  8. 625401Domain d1xb1f_: 1xb1 F: [115053]
    first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L
    complexed with zn

Details for d1xb1f_

PDB Entry: 1xb1 (more details), 2.7 Å

PDB Description: The Structure of the BIR domain of IAP-like protein 2

SCOP Domain Sequences for d1xb1f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb1f_ g.52.1.1 (F:) BIR-containing protein 8 {Human (Homo sapiens)}
nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
dpweqhakwypgckylleekgheyinnih

SCOP Domain Coordinates for d1xb1f_:

Click to download the PDB-style file with coordinates for d1xb1f_.
(The format of our PDB-style files is described here.)

Timeline for d1xb1f_: