![]() | Class g: Small proteins [56992] (94 folds) |
![]() | Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily) metal(zinc)-bound alpha+beta fold |
![]() | Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) ![]() |
![]() | Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins) |
![]() | Protein BIR-containing protein 8 [118349] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries) Uniprot Q96P09 1-84 |
![]() | Domain d1xb1c_: 1xb1 C: [115050] first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L complexed with zn |
PDB Entry: 1xb1 (more details), 2.7 Å
SCOPe Domain Sequences for d1xb1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1xb1c_ g.52.1.1 (C:) BIR-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]} nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke dpweqhakwypgckylleekgheyinnihl
Timeline for d1xb1c_: