Lineage for d1xb1a_ (1xb1 A:)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2264524Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2264525Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2264526Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2264646Protein BIR-containing protein 8 [118349] (1 species)
  7. 2264647Species Human (Homo sapiens) [TaxId:9606] [118350] (2 PDB entries)
    Uniprot Q96P09 1-84
  8. 2264654Domain d1xb1a_: 1xb1 A: [115048]
    first BIR domain; complexed with a diablo homolog peptide, chains G, H, I, J, K, L
    complexed with zn

Details for d1xb1a_

PDB Entry: 1xb1 (more details), 2.7 Å

PDB Description: The Structure of the BIR domain of IAP-like protein 2
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 8

SCOPe Domain Sequences for d1xb1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1xb1a_ g.52.1.1 (A:) BIR-containing protein 8 {Human (Homo sapiens) [TaxId: 9606]}
nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
dpweqhakwypgckylleekgheyinnihl

SCOPe Domain Coordinates for d1xb1a_:

Click to download the PDB-style file with coordinates for d1xb1a_.
(The format of our PDB-style files is described here.)

Timeline for d1xb1a_: