Lineage for d1x9fb_ (1x9f B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2685878Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2685879Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2685963Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2686083Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) [116754] (1 species)
  7. 2686084Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116755] (2 PDB entries)
    Uniprot P02218
  8. 2686085Domain d1x9fb_: 1x9f B: [114984]
    Other proteins in same PDB: d1x9fa_, d1x9fc_, d1x9fd_, d1x9fe_, d1x9fg_, d1x9fh_, d1x9fi_, d1x9fk_, d1x9fl_
    complexed with cmo, hem, po4

Details for d1x9fb_

PDB Entry: 1x9f (more details), 2.6 Å

PDB Description: hemoglobin dodecamer from lumbricus erythrocruorin
PDB Compounds: (B:) Globin II, extracellular

SCOPe Domain Sequences for d1x9fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1x9fb_ a.1.1.2 (B:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit II (globin B) {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
lgrcydreawdacidhiedgikghh

SCOPe Domain Coordinates for d1x9fb_:

Click to download the PDB-style file with coordinates for d1x9fb_.
(The format of our PDB-style files is described here.)

Timeline for d1x9fb_: