![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 [116758] (1 species) |
![]() | Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [116759] (2 PDB entries) Uniprot O61233 19-158 |
![]() | Domain d1x9fl_: 1x9f L: [114994] Other proteins in same PDB: d1x9fa_, d1x9fb_, d1x9fc_, d1x9fe_, d1x9ff_, d1x9fg_, d1x9fi_, d1x9fj_, d1x9fk_ complexed with cmo, hem, po4 |
PDB Entry: 1x9f (more details), 2.6 Å
SCOPe Domain Sequences for d1x9fl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1x9fl_ a.1.1.2 (L:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg thfdfgawhdcvdqiidgik
Timeline for d1x9fl_: