PDB entry 1x9f

View 1x9f on RCSB PDB site
Description: Hemoglobin Dodecamer from Lumbricus Erythrocruorin
Class: oxygen storage/transport
Keywords: Crystal; Dodecamer; Allosteric, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2004-08-20, released 2004-11-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.215
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Globin IV, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13579 (Start-150)
      • conflict (77)
    Domains in SCOPe 2.06: d1x9fa_
  • Chain 'B':
    Compound: Globin II, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02218 (0-144)
      • conflict (65)
    Domains in SCOPe 2.06: d1x9fb_
  • Chain 'C':
    Compound: Globin III, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11069
      • conflict (48)
    Domains in SCOPe 2.06: d1x9fc_
  • Chain 'D':
    Compound: Hemoglobin chain d1
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x9fd_
  • Chain 'E':
    Compound: Globin IV, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13579 (Start-150)
      • conflict (77)
    Domains in SCOPe 2.06: d1x9fe_
  • Chain 'F':
    Compound: Globin II, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02218 (0-144)
      • conflict (65)
    Domains in SCOPe 2.06: d1x9ff_
  • Chain 'G':
    Compound: Globin III, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11069
      • conflict (48)
    Domains in SCOPe 2.06: d1x9fg_
  • Chain 'H':
    Compound: Hemoglobin chain d1
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x9fh_
  • Chain 'I':
    Compound: Globin IV, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13579 (Start-150)
      • conflict (77)
    Domains in SCOPe 2.06: d1x9fi_
  • Chain 'J':
    Compound: Globin II, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02218 (0-144)
      • conflict (65)
    Domains in SCOPe 2.06: d1x9fj_
  • Chain 'K':
    Compound: Globin III, extracellular
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11069
      • conflict (48)
    Domains in SCOPe 2.06: d1x9fk_
  • Chain 'L':
    Compound: Hemoglobin chain d1
    Species: Lumbricus terrestris [TaxId:6398]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1x9fl_
  • Heterogens: PO4, HEM, CMO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9fA (A:)
    addedccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkide
    pesgefkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafa
    rvlpqvlscfnvdawnrcfhrlvariakdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fA (A:)
    dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg
    efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp
    qvlscfnvdawnrcfhrlvariakdlp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fB (B:)
    kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
    fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
    lgrcydreawdacidhiedgikghh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x9fC (C:)
    dehehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdie
    haegpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeil
    atglpqvlddydalawksclkgiltkissrlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fC (C:)
    hehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdieha
    egpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeilat
    glpqvlddydalawksclkgiltkissrl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fD (D:)
    eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
    ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
    thfdfgawhdcvdqiidgik
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1x9fE (E:)
    addedccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkide
    pesgefkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafa
    rvlpqvlscfnvdawnrcfhrlvariakdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fE (E:)
    dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg
    efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp
    qvlscfnvdawnrcfhrlvariakdlp
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fF (F:)
    kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
    fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
    lgrcydreawdacidhiedgikghh
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1x9fG (G:)
    dehehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdie
    haegpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeil
    atglpqvlddydalawksclkgiltkissrlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fG (G:)
    hehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdieha
    egpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeilat
    glpqvlddydalawksclkgiltkissrl
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fH (H:)
    eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
    ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
    thfdfgawhdcvdqiidgik
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1x9fI (I:)
    addedccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkide
    pesgefkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafa
    rvlpqvlscfnvdawnrcfhrlvariakdlp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fI (I:)
    dccsyedrreirhiwddvwsssftdrrvaivravfddlfkhyptskalfervkidepesg
    efkshlvrvanglkllinllddtlvlqshlghladqhiqrkgvtkeyfrgigeafarvlp
    qvlscfnvdawnrcfhrlvariakdlp
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fJ (J:)
    kkqcgvleglkvksewgraygsghdreafsqaiwratfaqvpesrslfkrvhgddtshpa
    fiahadrvlggldiaistldqpatlkeeldhlqvqhegrkipdnyfdafktailhvvaaq
    lgrcydreawdacidhiedgikghh
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1x9fK (K:)
    dehehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdie
    haegpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeil
    atglpqvlddydalawksclkgiltkissrlna
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9fK (K:)
    hehccseedhrivqkqwdilwrdtesskikigfgrllltklakdipevndlfkrvdieha
    egpkfsahalrilngldlainllddppaldaaldhlahqhevregvqkahfkkfgeilat
    glpqvlddydalawksclkgiltkissrl
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1x9fL (L:)
    eclvteslkvklqwasafghahervafglelwrdiiddhpeikapfsrvrgdniyspefg
    ahsqrvlsglditismldtpdmlaaqlahlkvqhvernlkpeffdiflkhllhvlgdrlg
    thfdfgawhdcvdqiidgik