Class b: All beta proteins [48724] (180 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) automatically mapped to Pfam PF03454 |
Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins) |
Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species) |
Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117334] (1 PDB entry) Uniprot O59354; PH1647 |
Domain d1wu2b1: 1wu2 B:325-396 [114887] Other proteins in same PDB: d1wu2a2, d1wu2a3, d1wu2b2, d1wu2b3 Structural genomics target |
PDB Entry: 1wu2 (more details), 2.3 Å
SCOPe Domain Sequences for d1wu2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wu2b1 b.85.6.1 (B:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]} evkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasnayleipedseg yrrgeevwitly
Timeline for d1wu2b1: