Lineage for d1wu2b2 (1wu2 B:6-180)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2820794Fold b.103: MoeA N-terminal region -like [63881] (1 superfamily)
    complex fold made of bifurcated and coiled b-sheets
  4. 2820795Superfamily b.103.1: MoeA N-terminal region -like [63882] (1 family) (S)
    automatically mapped to Pfam PF03453
  5. 2820796Family b.103.1.1: MoeA N-terminal region -like [63883] (3 proteins)
  6. 2820804Protein Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains [63884] (4 species)
  7. 2820841Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117342] (1 PDB entry)
    Uniprot O59354
  8. 2820843Domain d1wu2b2: 1wu2 B:6-180 [114888]
    Other proteins in same PDB: d1wu2a1, d1wu2a3, d1wu2b1, d1wu2b3
    Structural genomics target; PH1647

Details for d1wu2b2

PDB Entry: 1wu2 (more details), 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3
PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1wu2b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu2b2 b.103.1.1 (B:6-180) Molybdenum cofactor biosynthesis protein MoeA, N-terminal and linker domains {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk

SCOPe Domain Coordinates for d1wu2b2:

Click to download the PDB-style file with coordinates for d1wu2b2.
(The format of our PDB-style files is described here.)

Timeline for d1wu2b2: