Lineage for d1wu2b3 (1wu2 B:181-324)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890089Fold c.57: Molybdenum cofactor biosynthesis proteins [53217] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 5 strands; order: 21354, strand 5 is antiparallel to the rest; permutation of the Phosphorylase/hydrolase-like fold
  4. 2890090Superfamily c.57.1: Molybdenum cofactor biosynthesis proteins [53218] (3 families) (S)
  5. 2890184Family c.57.1.2: MoeA central domain-like [64103] (2 proteins)
    automatically mapped to Pfam PF00994
  6. 2890192Protein MoeA, central domain [64104] (4 species)
  7. 2890229Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117666] (1 PDB entry)
    Uniprot O59354
  8. 2890231Domain d1wu2b3: 1wu2 B:181-324 [114889]
    Other proteins in same PDB: d1wu2a1, d1wu2a2, d1wu2b1, d1wu2b2
    Structural genomics target; PH1647

Details for d1wu2b3

PDB Entry: 1wu2 (more details), 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3
PDB Compounds: (B:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1wu2b3:

Sequence, based on SEQRES records: (download)

>d1wu2b3 c.57.1.2 (B:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
vsvfaqfnlfvkhalakmvgaqny

Sequence, based on observed residues (ATOM records): (download)

>d1wu2b3 c.57.1.2 (B:181-324) MoeA, central domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
ketlekaknecdivlitgfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvk
halakmvgaqny

SCOPe Domain Coordinates for d1wu2b3:

Click to download the PDB-style file with coordinates for d1wu2b3.
(The format of our PDB-style files is described here.)

Timeline for d1wu2b3: