PDB entry 1wu2

View 1wu2 on RCSB PDB site
Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3
Class: structural genomics,biosynthetic protein
Keywords: moeA protein, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL GENOMICS,BIOSYNTHETIC PROTEIN
Deposited on 2004-11-30, released 2004-12-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.236
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: molybdopterin biosynthesis moea protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143497 (Start-395)
      • modified residue (117)
      • modified residue (120)
      • modified residue (167)
      • modified residue (214)
      • modified residue (295)
      • modified residue (317)
    Domains in SCOPe 2.07: d1wu2a1, d1wu2a2, d1wu2a3
  • Chain 'B':
    Compound: molybdopterin biosynthesis moea protein
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143497 (Start-395)
      • modified residue (117)
      • modified residue (120)
      • modified residue (167)
      • modified residue (214)
      • modified residue (295)
      • modified residue (317)
    Domains in SCOPe 2.07: d1wu2b1, d1wu2b2, d1wu2b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wu2A (A:)
    mmefkklvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdg
    yairaedtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqe
    mvkregdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk
    vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
    ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
    vsvfaqfnlfvkhalakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikk
    kgsgilssllasnayleipedsegyrrgeevwitly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu2A (A:)
    klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
    edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
    gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvkvkpkv
    giiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesiiketle
    kaknecdivlitdyahkfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvkh
    alakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasn
    ayleipedsegyrrgeevwitly
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wu2B (B:)
    mmefkklvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdg
    yairaedtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqe
    mvkregdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvk
    vkpkvgiiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesii
    ketlekaknecdivlitggsafgdkdyahkfvnllfhgttikpgrpfgygekvfimsgyp
    vsvfaqfnlfvkhalakmvgaqnyevkvkailqddipsqlgryefikiyyengiarvikk
    kgsgilssllasnayleipedsegyrrgeevwitly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wu2B (B:)
    klvpyrealklllddineiedtekvplreavgrvlaedivtefdippfdraavdgyaira
    edtfqareynpieltvieevpagnvakeevttgkaikvltgtripkganavimqemvkre
    gdkiyvlrpvapgqniaftgedvkkgevvlrkgtilrpqdvamlkalgikkvpvkvkpkv
    giiitgselieepseegfkegkivetnsimlqglvekffgepilygvlpddesiiketle
    kaknecdivlitgfvnllfhgttikpgrpfgygekvfimsgypvsvfaqfnlfvkhalak
    mvgaqnyevkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasnayle
    ipedsegyrrgeevwitly