Lineage for d1wu2a1 (1wu2 A:325-396)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817864Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 2818545Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families) (S)
    automatically mapped to Pfam PF03454
  5. 2818546Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)
  6. 2818554Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)
  7. 2818591Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117334] (1 PDB entry)
    Uniprot O59354; PH1647
  8. 2818592Domain d1wu2a1: 1wu2 A:325-396 [114884]
    Other proteins in same PDB: d1wu2a2, d1wu2a3, d1wu2b2, d1wu2b3
    Structural genomics target

Details for d1wu2a1

PDB Entry: 1wu2 (more details), 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3
PDB Compounds: (A:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1wu2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wu2a1 b.85.6.1 (A:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
evkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasnayleipedseg
yrrgeevwitly

SCOPe Domain Coordinates for d1wu2a1:

Click to download the PDB-style file with coordinates for d1wu2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wu2a1: