SCOPe 2.08: Domain d1wu2a1: 1wu2 A:325-396

Lineage for d1wu2a1 (1wu2 A:325-396)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.85: beta-clip [51268] (7 superfamilies)
   double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll

4. Superfamily b.85.6: MoeA C-terminal domain-like [63867] (2 families)
   automatically mapped to Pfam PF03454

5. Family b.85.6.1: MoeA C-terminal domain-like [63868] (2 proteins)

6. Protein Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain [63869] (4 species)

7. Species Pyrococcus horikoshii, PH1647 [TaxId:53953] [117334] (1 PDB entry)
   Uniprot O59354; PH1647

8. Domain d1wu2a1: 1wu2 A:325-396 [114884]
   Other proteins in same PDB: d1wu2a2, d1wu2a3, d1wu2b2, d1wu2b3
   Structural genomics target

Details for d1wu2a1

PDB Entry: 1wu2, 2.3 Å

PDB Description: Crystal Structure of molybdopterin biosynthesis moeA protein from Pyrococcus horikoshii OT3

PDB Compounds: (A:) molybdopterin biosynthesis moea protein

SCOPe Domain Sequences for d1wu2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wu2a1 b.85.6.1 (A:325-396) Molybdenum cofactor biosynthesis protein MoeA, C-terminal domain {Pyrococcus horikoshii, PH1647 [TaxId: 53953]}
evkvkailqddipsqlgryefikiyyengiarvikkkgsgilssllasnayleipedseg
yrrgeevwitly

Timeline for d1wu2a1:

• d1wu2a1 first appeared in SCOP 1.71
  
• d1wu2a1 appears in SCOPe 2.07