SCOPe 2.08: Domain d1wlhb1: 1wlh B:549-647

Lineage for d1wlhb1 (1wlh B:549-647)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
   Pfam PF00630

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)
   Uniprot P13466 547-857

8. Domain d1wlhb1: 1wlh B:549-647 [114731]

Details for d1wlhb1

PDB Entry: 1wlh, 2.8 Å

PDB Description: molecular structure of the rod domain of dictyostelium filamin

PDB Compounds: (B:) gelation factor

SCOPe Domain Sequences for d1wlhb1:

Sequence, based on SEQRES records:

>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkp

Sequence, based on observed residues (ATOM records):

>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
adpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdngdg
tydvefepkeagdyvinltldgdnvngfpktvtvkp

Timeline for d1wlhb1:

• d1wlhb1 first appeared in SCOP 1.71
  
• d1wlhb1 appears in SCOPe 2.07