PDB entry 1wlh

View 1wlh on RCSB PDB site
Description: Molecular structure of the rod domain of Dictyostelium filamin
Class: structural protein
Keywords: ABP-120, filamin, Immunoglobulin fold, rod domain, STRUCTURAL PROTEIN
Deposited on 2004-06-27, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gelation factor
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: ABPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wlha1, d1wlha2, d1wlha3
  • Chain 'B':
    Compound: gelation factor
    Species: Dictyostelium discoideum [TaxId:44689]
    Gene: ABPC
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wlhb1, d1wlhb2, d1wlhb3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wlhA (A:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmv
    dngdgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfd
    napaeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegn
    ynvnvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsi
    tgpaeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpe
    vksftttrtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlhA (A:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdng
    dgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfdnap
    aeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegnynv
    nvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsitgp
    aeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpevks
    ftttrtan
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wlhB (B:)
    paadpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmv
    dngdgtydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfd
    napaeftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegn
    ynvnvtlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsi
    tgpaeeitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpe
    vksftttrtan
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wlhB (B:)
    adpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdngdg
    tydvefepkeagdyvinltldgdnvngfpktvtvkpapsaehsyaegeglvkvfdnapae
    ftifavdtkgvartdggdpfevaingpdglvvdakvtdnndgtygvvydapvegnynvnv
    tlrgnpiknmpidvkciegangedssfgsftftvaaknkkgevktyggdkfevsitgpae
    eitldaidnqdgtytaayslvgngrfstgvklngkhiegspfkqvlgnpgkknpevksft
    ttrtan