SCOP 1.71: Domain d1wlhb1: 1wlh B:549-647

Lineage for d1wlhb1 (1wlh B:549-647)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (18 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.10: Filamin repeat (rod domain) [81290] (2 proteins)
   Pfam 00630

6. Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)

7. Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)

8. Domain d1wlhb1: 1wlh B:549-647 [114731]

Details for d1wlhb1

PDB Entry: 1wlh, 2.8 Å

PDB Description: molecular structure of the rod domain of dictyostelium filamin

SCOP Domain Sequences for d1wlhb1:

Sequence, based on SEQRES records:

>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
adpeksyaegpgldggecfqpskfkihavdpdgvhrtdggdgfvvtiegpapvdpvmvdn
gdgtydvefepkeagdyvinltldgdnvngfpktvtvkp

Sequence, based on observed residues (ATOM records):

>d1wlhb1 b.1.18.10 (B:549-647) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum)}
adpeksyaegpgldggecfqpskfkihavdpdgvdggdgfvvtiegpapvdpvmvdngdg
tydvefepkeagdyvinltldgdnvngfpktvtvkp

Timeline for d1wlhb1:

• d1wlhb1 is new in SCOP 1.71
  
• d1wlhb1 appears in SCOP 1.73
  
• d1wlhb1 appears in the current release, SCOPe 2.08