Lineage for d1wlha2 (1wlh A:648-749)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765751Family b.1.18.10: Filamin repeat (rod domain) [81290] (5 proteins)
    Pfam PF00630
  6. 2765752Protein F-actin cross-linking gelation factor (ABP-120) repeats [49239] (1 species)
  7. 2765753Species Slime mold (Dictyostelium discoideum) [TaxId:44689] [49240] (3 PDB entries)
    Uniprot P13466 547-857
  8. 2765759Domain d1wlha2: 1wlh A:648-749 [114729]

Details for d1wlha2

PDB Entry: 1wlh (more details), 2.8 Å

PDB Description: molecular structure of the rod domain of dictyostelium filamin
PDB Compounds: (A:) gelation factor

SCOPe Domain Sequences for d1wlha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlha2 b.1.18.10 (A:648-749) F-actin cross-linking gelation factor (ABP-120) repeats {Slime mold (Dictyostelium discoideum) [TaxId: 44689]}
apsaehsyaegeglvkvfdnapaeftifavdtkgvartdggdpfevaingpdglvvdakv
tdnndgtygvvydapvegnynvnvtlrgnpiknmpidvkcie

SCOPe Domain Coordinates for d1wlha2:

Click to download the PDB-style file with coordinates for d1wlha2.
(The format of our PDB-style files is described here.)

Timeline for d1wlha2: