SCOP 1.73: Domain d1whwa_: 1whw A:

Lineage for d1whwa_ (1whw A:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families)

5. Family d.58.7.1: Canonical RBD [54929] (67 proteins)

6. Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [117970] (4 PDB entries)

8. Domain d1whwa_: 1whw A: [114653]
   Structural genomics target; 3rd RBD

Details for d1whwa_

PDB Entry: 1whw

PDB Description: solution structure of the n-terminal rna binding domain from hypothetical protein bab23448

PDB Compounds: (A:) hypothetical protein RIKEN CDNA 1200009A02

SCOP Domain Sequences for d1whwa_:

Sequence; same for both SEQRES and ATOM records:

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgsgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfp
ehavkayaevdgqvfqgrmlhvlpstikkeasqsgpssg

Timeline for d1whwa_:

• d1whwa_ first appeared in SCOP 1.71
  
• d1whwa_ appears in SCOP 1.75
  
• d1whwa_ appears in the current release, SCOPe 2.08, called d1whwa1