Lineage for d1whwa_ (1whw A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603243Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 603934Superfamily d.58.7: RNA-binding domain, RBD [54928] (4 families) (S)
  5. 603935Family d.58.7.1: Canonical RBD [54929] (32 proteins)
  6. 604056Protein Probable RNA-binding protein 19, Rbm19 [117969] (1 species)
  7. 604057Species Mouse (Mus musculus) [TaxId:10090] [117970] (2 PDB entries)
  8. 604058Domain d1whwa_: 1whw A: [114653]
    Structural genomics target; 3rd RBD

Details for d1whwa_

PDB Entry: 1whw (more details)

PDB Description: solution structure of the n-terminal rna binding domain from hypothetical protein bab23448

SCOP Domain Sequences for d1whwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus)}
gssgssgsgrlfvrnlsytsseedleklfsaygplselhypidsltkkpkgfafvtfmfp
ehavkayaevdgqvfqgrmlhvlpstikkeasqsgpssg

SCOP Domain Coordinates for d1whwa_:

Click to download the PDB-style file with coordinates for d1whwa_.
(The format of our PDB-style files is described here.)

Timeline for d1whwa_: